DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and ypt4

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_594796.1 Gene:ypt4 / 2542113 PomBaseID:SPAC1B3.11c Length:234 Species:Schizosaccharomyces pombe


Alignment Length:248 Identity:50/248 - (20%)
Similarity:82/248 - (33%) Gaps:92/248 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEE--SWHVQVRLHEYSKPVILPPTPTWTTP 74
            |:|::.|..|.||:.|.......: .....|.|||.:  |..:.|.:....|.:.|   ..|.|.
pombe    10 VKIVLAGPSGTGKSCLLQRFVKNQ-WDDQVSHTVGIDFASRIISVGMGNQQKRIKL---QIWDTA 70

  Fly    75 SSSEDSENYPYMRSTPTTTNILYFVEFYDLNSDWRMCRQQRESFYKNIDGIVLVYNMLELSSQDS 139
            ...:                                .|....::|:...|.||||::....|.:.
pombe    71 GQEK--------------------------------FRSVARNYYRGAAGAVLVYDVTNKDSFEE 103

  Fly   140 LHDWLYDPLRQICKHRHLRIRSILKNHNAP----ILVVGTNLDKLMRRPL----------RRRGS 190
            |..||.|            ||::     ||    :::.|:..|...:|.:          .:..|
pombe   104 LSSWLSD------------IRAM-----APSTICVVLAGSKSDLQNQRQVSTEEAAEFCSEKHIS 151

  Fly   191 IAHQL------NVEEMLVNC------------LDPQSFVDKSRNQGKLYGFLN 225
            .||:.      ||||..::.            :|||     .::.|..||.|:
pombe   152 SAHETSSYTGSNVEECFLSVVSTIITRIELGEIDPQ-----DQSLGIQYGDLS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 50/248 (20%)
ypt4NP_594796.1 RAB 10..178 CDD:197555 43/220 (20%)
Rab 10..173 CDD:206640 43/215 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47980
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.