DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15399 and rabl3

DIOPT Version :9

Sequence 1:NP_608712.1 Gene:CG15399 / 33472 FlyBaseID:FBgn0031460 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001096295.1 Gene:rabl3 / 100124869 XenbaseID:XB-GENE-6258935 Length:235 Species:Xenopus tropicalis


Alignment Length:236 Identity:66/236 - (27%)
Similarity:106/236 - (44%) Gaps:55/236 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VRILMLGDRGVGKTSLTNLMATTEITPTPDSRTVGEESWHVQVRLHEYSKPVILPPTPTWTTPSS 76
            |::|:|||.||||:||.:|:...::...| |.|||   ..|.||||||.:     .||...|   
 Frog     7 VKVLVLGDSGVGKSSLVHLLCQNQVLGNP-SWTVG---CSVDVRLHEYRE-----GTPEEKT--- 59

  Fly    77 SEDSENYPYMRSTPTTTNILYFVEFYDLN---SDWRMCRQQRESFYKNIDGIVLVYNMLELSSQD 138
                                |::|.:|:.   ......:..|..||..::||:||:::....|..
 Frog    60 --------------------YYIELWDVGGSVGSASSVKSTRAVFYNAVNGIILVHDLTNKKSSQ 104

  Fly   139 SLHDWLYDPLRQICKHRHLRIRSIL-----------KNHNAPILVVGTNLDKL----MRRPLRRR 188
            :|:.|..:.|     :|.|:...:|           .::..|:||:||.||::    ....|.|.
 Frog   105 NLYRWSLEAL-----NRDLQPTGVLVTNGDYDREQFADNQIPLLVIGTKLDQIPEAKRSEVLTRT 164

  Fly   189 GSIAHQLNVEEMLVNCLDPQSFVDKSRNQGKLYGFLNRVIE 229
            ..:|...|.||:.::|.:.:.....|.|..||..|.::|||
 Frog   165 AFLAEDFNAEEINLDCTNTRCLAAGSSNAVKLSRFFDKVIE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15399NP_608712.1 P-loop_NTPase 12..229 CDD:304359 64/234 (27%)
rabl3NP_001096295.1 Small GTPase-like 1..235 66/236 (28%)
RabL3 7..208 CDD:206689 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1269342at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.