DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and HNT2

DIOPT Version :9

Sequence 1:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_010591.1 Gene:HNT2 / 851899 SGDID:S000002713 Length:217 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:31/100 - (31%)
Similarity:43/100 - (43%) Gaps:6/100 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIP-RKPIAQLS-LAEDGDADLLGHLMLVG 105
            |.|.|..|   :..::.....|..::.|..|.|.|::| |..:..|| |......|....|.|:.
Yeast    18 FSKFLVTE---QVFYKSKYTYALVNLKPIVPGHVLIVPLRTTVLNLSDLTMPESQDYFKTLQLIH 79

  Fly   106 RKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFL 140
            |.: |....||...|.|.:|....|||.|||.|.:
Yeast    80 RFI-KWQYKADSINVAIQDGPEAGQSVPHLHTHII 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 31/99 (31%)
HNT2NP_010591.1 FHIT 16..135 CDD:238606 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.