DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and HNT1

DIOPT Version :9

Sequence 1:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_010158.1 Gene:HNT1 / 851432 SGDID:S000002283 Length:158 Species:Saccharomyces cerevisiae


Alignment Length:133 Identity:44/133 - (33%)
Similarity:63/133 - (47%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SARMASEVEKSQTAAASEDTIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQ 86
            ||...:..:.|..|......||.||::.|||...:.|.....||.|:.|.|..|.|:||:...|:
Yeast     6 SAPYLTTTKMSAPATLDAACIFCKIIKSEIPSFKLIETKYSYAFLDIQPTAEGHALIIPKYHGAK 70

  Fly    87 LSLAEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFL------GGRQM 145
            |   .|...:.|...|.:.:::||.:.| |.|.|:.||||...|.|.|:|.|.:      .|..:
Yeast    71 L---HDIPDEFLTDAMPIAKRLAKAMKL-DTYNVLQNNGKIAHQEVDHVHFHLIPKRDEKSGLIV 131

  Fly   146 QWP 148
            .||
Yeast   132 GWP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 37/107 (35%)
HNT1NP_010158.1 HINT_subgroup 25..122 CDD:238608 37/100 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I2922
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I1781
Isobase 1 0.950 - 0.861654 Normalized mean entropy S1022
OMA 1 1.010 - - QHG60959
OrthoFinder 1 1.000 - - FOG0001332
OrthoInspector 1 1.000 - - oto100016
orthoMCL 1 0.900 - - OOG6_100377
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2151
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.