DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and HIT3

DIOPT Version :9

Sequence 1:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_567038.1 Gene:HIT3 / 824816 AraportID:AT3G56490 Length:147 Species:Arabidopsis thaliana


Alignment Length:139 Identity:71/139 - (51%)
Similarity:92/139 - (66%) Gaps:3/139 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SRQIASCSARMASEVEKSQTAAASED-TIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLV 78
            |...:..||.||||.|.:..|..|:. |||.||:.||||...:.||||.:||.|:.||.|.|.|:
plant     9 SSHFSPASAVMASEKEAALAATPSDSPTIFDKIISKEIPSTVVFEDDKVLAFRDITPQGPVHILL 73

  Fly    79 IP--RKPIAQLSLAEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLG 141
            ||  |..:..||.||:...|:||.|:...:.|||:.|||:|:|:|||:|..|.|||||:|:|.:|
plant    74 IPKVRDGLTGLSKAEERHIDILGRLLYTAKLVAKQEGLAEGFRIVINDGPQGCQSVYHIHVHLIG 138

  Fly   142 GRQMQWPPG 150
            ||||.||||
plant   139 GRQMNWPPG 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 52/104 (50%)
HIT3NP_567038.1 PKCI_related 35..139 CDD:238607 52/103 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 109 1.000 Domainoid score I2121
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3904
Inparanoid 1 1.050 141 1.000 Inparanoid score I1785
OMA 1 1.010 - - QHG60959
OrthoDB 1 1.010 - - D1190598at2759
OrthoFinder 1 1.000 - - FOG0001332
OrthoInspector 1 1.000 - - otm3015
orthoMCL 1 0.900 - - OOG6_100377
Panther 1 1.100 - - O PTHR23089
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1204
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.