DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and hint2

DIOPT Version :9

Sequence 1:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001077041.1 Gene:hint2 / 798688 ZFINID:ZDB-GENE-070410-139 Length:161 Species:Danio rerio


Alignment Length:152 Identity:85/152 - (55%)
Similarity:110/152 - (72%) Gaps:7/152 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSTGRNFFRVFSSRQIASCSARMASEVEKSQTAAAS----EDTIFGKILRKEIPCKFIHEDDKCV 63
            |..||..:||.|   :.||.:.:..||..:|.|:..    |.|||.||:.|.:|...|:|||||:
Zfish    13 LPFGRGLWRVLS---VKSCYSTINDEVRLAQEASKKYGKLEPTIFTKIIDKTVPAVIIYEDDKCL 74

  Fly    64 AFHDVAPQAPTHFLVIPRKPIAQLSLAEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHG 128
            ||.||.||||.|:|||||.||.::|.|.|.|:.:||||::|.:.:||:.|||:|||||||:||:|
Zfish    75 AFRDVNPQAPVHYLVIPRIPIPRISEAHDEDSLILGHLLVVAKNIAKKEGLAEGYRVVINDGKNG 139

  Fly   129 AQSVYHLHLHFLGGRQMQWPPG 150
            ||||||||:|.||||||:||||
Zfish   140 AQSVYHLHIHVLGGRQMKWPPG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 63/101 (62%)
hint2NP_001077041.1 PKCI_related 51..153 CDD:238607 63/101 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60959
OrthoDB 1 1.010 - - D1190598at2759
OrthoFinder 1 1.000 - - FOG0001332
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100377
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1204
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.