DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and Hint2

DIOPT Version :9

Sequence 1:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_081147.1 Gene:Hint2 / 68917 MGIID:1916167 Length:163 Species:Mus musculus


Alignment Length:148 Identity:82/148 - (55%)
Similarity:105/148 - (70%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RQIASCSARMA-----------SEVEKSQTAA--ASEDTIFGKILRKEIPCKFIHEDDKCVAFHD 67
            |.:|:..||.|           |||.|:|.||  .:..|||.:||.:.:|...::||.:|:.|.|
Mouse    16 RTLAAAGARGAQVRGNAGVSDGSEVAKAQKAAPGGASPTIFSRILDRSLPADILYEDQQCLVFRD 80

  Fly    68 VAPQAPTHFLVIPRKPIAQLSLAEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSV 132
            ||||||.||||||||||.::|.||:.|..|||||:||.:|:|:..||.||||:|:|:||.|||||
Mouse    81 VAPQAPVHFLVIPRKPIPRISQAEEDDQQLLGHLLLVAKKIAQAQGLKDGYRLVVNDGKMGAQSV 145

  Fly   133 YHLHLHFLGGRQMQWPPG 150
            ||||:|.|||||:|||||
Mouse   146 YHLHIHVLGGRQLQWPPG 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 61/101 (60%)
Hint2NP_081147.1 PKCI_related 53..155 CDD:238607 61/101 (60%)
Histidine triad motif 147..151 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835924
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60959
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001332
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100377
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2151
SonicParanoid 1 1.000 - - X1204
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.680

Return to query results.
Submit another query.