DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and si:dkey-25e12.3

DIOPT Version :9

Sequence 1:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001020726.2 Gene:si:dkey-25e12.3 / 678527 ZFINID:ZDB-GENE-041001-132 Length:160 Species:Danio rerio


Alignment Length:115 Identity:41/115 - (35%)
Similarity:57/115 - (49%) Gaps:16/115 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 EDTIFGKILRKEIPC----------KFIHEDDKCVAFHDVAPQAPTHFLVIPRKPI-AQLSLAED 92
            :|||...:.:..|.|          :.:.||:..|.|.|:.|.||.|:||||:|.| :.|||..|
Zfish    12 QDTIDESLDKTCIFCTIAKGDDRYTEILAEDEDFVCFRDINPGAPHHYLVIPKKHIYSCLSLYAD 76

  Fly    93 GDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQ--SVYHLHLHFL 140
             |..|:..:..:||.|.|...:.|  ...|:.|.|...  :|.|||||.|
Zfish    77 -DISLVRGMAEMGRNVLKANNVTD--LKDISLGFHVPPYITVPHLHLHVL 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 41/114 (36%)
si:dkey-25e12.3NP_001020726.2 HIT_like 22..124 CDD:294158 38/105 (36%)
Histidine triad motif 117..121 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.