DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and hint1

DIOPT Version :9

Sequence 1:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001005593.1 Gene:hint1 / 449551 ZFINID:ZDB-GENE-040927-8 Length:126 Species:Danio rerio


Alignment Length:126 Identity:80/126 - (63%)
Similarity:104/126 - (82%) Gaps:0/126 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 MASEVEKSQTAAASEDTIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQLSL 89
            ||.||.::|:|....|||||||:|||||...|:|||:|:||:||||||||||||:|||||:|:|.
Zfish     1 MADEVSRAQSAQPGGDTIFGKIIRKEIPANIIYEDDQCIAFNDVAPQAPTHFLVVPRKPISQISK 65

  Fly    90 AEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLGGRQMQWPPG 150
            .||.|.:||||:|:|.:|.|:::||..|||:|:|:|..|.|||||:|:|.|||||:.||||
Zfish    66 VEDADKELLGHMMIVAKKCAEQVGLPRGYRLVVNDGPDGGQSVYHIHIHVLGGRQLGWPPG 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 66/101 (65%)
hint1NP_001005593.1 PKCI_related 16..118 CDD:238607 66/101 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579323
Domainoid 1 1.000 146 1.000 Domainoid score I4503
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3904
Inparanoid 1 1.050 183 1.000 Inparanoid score I3954
OMA 1 1.010 - - QHG60959
OrthoDB 1 1.010 - - D1190598at2759
OrthoFinder 1 1.000 - - FOG0001332
OrthoInspector 1 1.000 - - oto40992
orthoMCL 1 0.900 - - OOG6_100377
Panther 1 1.100 - - LDO PTHR23089
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2151
SonicParanoid 1 1.000 - - X1204
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.