DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and HINT3

DIOPT Version :9

Sequence 1:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_974907.1 Gene:HINT3 / 2746201 AraportID:AT5G48545 Length:197 Species:Arabidopsis thaliana


Alignment Length:127 Identity:35/127 - (27%)
Similarity:67/127 - (52%) Gaps:7/127 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QIASCSARMASEVEKSQTAAASEDTIFGKILRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPR 81
            :::.||:..:.: .|.:::....|.:|.||:|.|.||..::|||.|:...|..|.:..|.|:||:
plant    27 RVSDCSSGSSGD-GKVESSTLQNDCVFCKIIRGESPCLKLYEDDMCLCILDTNPLSHGHSLIIPK 90

  Fly    82 KPIAQLSLAEDGD---ADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFL 140
              :...:|.|...   |.:...:.|:...:.|..| :|.:.:::|||....|.::|.|:|.:
plant    91 --LHYPTLEETPPSVVAAMCSKVPLISNAIVKATG-SDSFNLLVNNGAAAGQVIFHTHIHII 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 32/104 (31%)
HINT3NP_974907.1 HINT_subgroup 49..151 CDD:238608 32/104 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1190598at2759
OrthoFinder 1 1.000 - - FOG0001332
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100377
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.