DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and Hint3

DIOPT Version :9

Sequence 1:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001094295.1 Gene:Hint3 / 246769 RGDID:621603 Length:175 Species:Rattus norvegicus


Alignment Length:130 Identity:31/130 - (23%)
Similarity:56/130 - (43%) Gaps:17/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SARMASEVEKSQTAAASE---DTIFGKILRKEIP------CKFIHEDDKCVAFHDVAPQAPTHFL 77
            :|:...||....|:.:.:   :.:|.::...:.|      |    |:...|.|.|:.|.|..|:|
  Rat    19 TAKAGPEVSSPGTSESRDYDSNCVFCRVAAGQEPETELLYC----ENKDLVCFKDIKPAALHHYL 79

  Fly    78 VIPRKPIAQLSLAEDGDADLLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQ--SVYHLHLHFL 140
            |:|:|.|...........:::..::.||:.:.:.....|  ...:..|.|...  ||.|||||.:
  Rat    80 VVPKKHIGSCKDLNKDHIEMVESMVTVGKTILERNNFTD--FTDVRMGFHVPPFCSVSHLHLHVI 142

  Fly   141  140
              Rat   143  142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 27/109 (25%)
Hint3NP_001094295.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 4/15 (27%)
aprataxin_related 40..143 CDD:238609 27/109 (25%)
Histidine triad motif 136..140 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.