DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HINT1 and hint-3

DIOPT Version :9

Sequence 1:NP_001259964.1 Gene:HINT1 / 33471 FlyBaseID:FBgn0031459 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001256089.1 Gene:hint-3 / 182943 WormBaseID:WBGene00016150 Length:200 Species:Caenorhabditis elegans


Alignment Length:123 Identity:35/123 - (28%)
Similarity:57/123 - (46%) Gaps:25/123 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 CKF-----------IHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQLSLAEDGDADLLGHLMLVGR 106
            |||           :.|:..||..:|:.|:|..|:||:.::.||:.:.....|..||..:...||
 Worm    36 CKFCDIVKNKKELQLKENKSCVVINDIKPKAKNHYLVLSKQHIAKPTDLTVADVPLLEEMEKTGR 100

  Fly   107 KVAKE----LGLADGYRVVINNGKH--GAQSVYHLHLHF--------LGGRQMQWPPG 150
            ::.:|    .|.||....::..|.|  ...||:|||:|.        |..|::.:.||
 Worm   101 ELLREHLKKKGEADTVEDMLRIGFHLPPLLSVHHLHMHIIYPISDMGLISRKLTFRPG 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HINT1NP_001259964.1 PKCI_related 40..142 CDD:238607 32/113 (28%)
hint-3NP_001256089.1 aprataxin_related 35..141 CDD:238609 31/104 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.