DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and ORT1

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_014773.4 Gene:ORT1 / 854297 SGDID:S000005656 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:81/293 - (27%)
Similarity:137/293 - (46%) Gaps:34/293 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGV-RGLYKG 79
            :...:.|...|.|..:...|.||:||||||.      ...::..|:.|...|.:|||: ||.::|
Yeast    14 ILDIINGSIAGACGKVIEFPFDTVKVRLQTQ------ASNVFPTTWSCIKFTYQNEGIARGFFQG 72

  Fly    80 MSAPLTGVAPIFAMCFAGY-ALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLL 143
            :::||.|.....|..|..| ...|.|::....:.|  .||.::|..:|..::|::.|.|.:|..|
Yeast    73 IASPLVGACLENATLFVSYNQCSKFLEKHTNVSPL--GQILISGGVAGSCASLVLTPVELVKCKL 135

  Fly   144 QTQ--QGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYE--------- 197
            |..  |....:.|:..::.....:..|.||..:::|...|.:|:......:|..||         
Yeast   136 QVANLQVASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDR 200

  Fly   198 -ALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKH-GIRSVFKD 260
             :|.|..:.:|:..::     :.:||.||:|:.....|||.:||.:|:      :| .:.:..|.
Yeast   201 HSLDDPKRDESKIWEL-----LISGGSAGLAFNASIFPADTVKSVMQT------EHISLTNAVKK 254

  Fly   261 LIVKDGPLALYRGVTPIMLRAFPANAACFFGIE 293
            :..|.|....|||:...:.||.|||||.|:..|
Yeast   255 IFGKFGLKGFYRGLGITLFRAVPANAAVFYIFE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 29/92 (32%)
Mito_carr 112..202 CDD:395101 23/101 (23%)
Mito_carr 210..299 CDD:395101 27/85 (32%)
ORT1NP_014773.4 Mito_carr 16..101 CDD:395101 29/90 (32%)
Mito_carr 103..200 CDD:395101 22/98 (22%)
Mito_carr 209..289 CDD:395101 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.