DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and BAC2

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_178108.1 Gene:BAC2 / 844329 AraportID:AT1G79900 Length:296 Species:Arabidopsis thaliana


Alignment Length:292 Identity:98/292 - (33%)
Similarity:156/292 - (53%) Gaps:28/292 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMS 81
            :.|:.|||||:..::||:||||:::|.|...:..        ..|....:.:..||...||:||:
plant    14 REFVAGGFGGVAGIISGYPLDTLRIRQQQSSKSG--------SAFSILRRMLAIEGPSSLYRGMA 70

  Fly    82 APLTGVAPIFAMCFAGYALGKRLQQRGEDAKL------TYPQIFVAGSFSGLFSTLIMAPGERIK 140
            |||..|....||.|..||    :..|..|:.:      :|..:.:.|..:|...:|::.|.|.||
plant    71 APLASVTFQNAMVFQIYA----IFSRSFDSSVPLVEPPSYRGVALGGVATGAVQSLLLTPVELIK 131

  Fly   141 VLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQD-VAK 204
            :.||.||.:      :|.|..|..:.:..||:.:::|...|:|||.||:||||..||.::: :..
plant   132 IRLQLQQTK------SGPITLAKSILRRQGLQGLYRGLTITVLRDAPAHGLYFWTYEYVRERLHP 190

  Fly   205 SKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKDGPLA 269
            ...:|||.:..:.:.|||:||:|.|:...|.||:|:|||.. .|.|: ||...|:..:.::|...
plant   191 GCRKTGQENLRTMLVAGGLAGVASWVACYPLDVVKTRLQQG-HGAYE-GIADCFRKSVKQEGYTV 253

  Fly   270 LYRGVTPIMLRAFPANAACFFGIELANK-FFN 300
            |:||:...:.|||..|.|.|...|:|.: .||
plant   254 LWRGLGTAVARAFVVNGAIFAAYEVALRCLFN 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 30/89 (34%)
Mito_carr 112..202 CDD:395101 30/96 (31%)
Mito_carr 210..299 CDD:395101 33/89 (37%)
BAC2NP_178108.1 Mito_carr <30..94 CDD:365909 24/75 (32%)
Mito_carr 111..189 CDD:365909 29/83 (35%)
Mito_carr 204..285 CDD:365909 31/82 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.