DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and SLC25A2

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_114153.1 Gene:SLC25A2 / 83884 HGNCID:22921 Length:301 Species:Homo sapiens


Alignment Length:288 Identity:91/288 - (31%)
Similarity:140/288 - (48%) Gaps:23/288 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLTG 86
            |..||...||:|.|.|||||::||.|       .||:|..||..||....|:||.|||....|..
Human    16 GAAGGTACVLTGQPFDTIKVKMQTFP-------DLYKGLTDCFLKTYAQVGLRGFYKGTGPALMA 73

  Fly    87 VA---PIFAMCFAGYA--LGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQT- 145
            ..   .:..||: |:.  ..:::....:.|||:..|...||||:..|:.|.:.|.|.:|..||| 
Human    74 YVAENSVLFMCY-GFCQQFVRK
VAGMDKQAKLSDLQTAAAGSFASAFAALALCPTELVKCRLQTM 137

  Fly   146 -QQGQGGE--RKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDV---AK 204
             :....|:  :.:|.:......:.|:.|....:.|..:|:|:::|....:|..||..:..   .:
Human   138 YEMEMSGKIAKSHNTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPGYFFFFGGYELSRSFFASGR 202

  Fly   205 SKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKDGPLA 269
            ||.|.|.:   ..:.:|||||:..|::..|.|.:|||:|.......:.|.......::..:|.:|
Human   203 SKDELGPV---HLMLSGGVAGICLWLVVFPVDCIKSRIQVLSMYGKQAGFIGTLLSVVRNEGIVA 264

  Fly   270 LYRGVTPIMLRAFPANAACFFGIELANK 297
            ||.|:...|:||.|||.|.|...|.:.|
Human   265 LYSGLKATMIRAIPANGALFVAYEYSRK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 32/89 (36%)
Mito_carr 112..202 CDD:395101 26/93 (28%)
Mito_carr 210..299 CDD:395101 29/88 (33%)
SLC25A2NP_114153.1 Solcar 1 7..91 32/82 (39%)
Mito_carr 9..94 CDD:278578 32/85 (38%)
Solcar 2 104..197 25/92 (27%)
Mito_carr <125..198 CDD:278578 17/72 (24%)
Mito_carr 205..296 CDD:278578 30/91 (33%)
Solcar 3 207..293 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.