DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and SLC25A20

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_000378.1 Gene:SLC25A20 / 788 HGNCID:1421 Length:301 Species:Homo sapiens


Alignment Length:293 Identity:154/293 - (52%)
Similarity:210/293 - (71%) Gaps:2/293 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYK 78
            :|:|:.|.|||||:|.|..||||||:||||||.|...||:.|:|.|||||..||:..||:.|||:
Human     9 SPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYR 73

  Fly    79 GMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLL 143
            ||:||:.||.|:||:||.|:.|||:|||:..:..|:|||:|.||..||:|:|.||.||||||.||
Human    74 GMAAPIIGVTPMFAVCFFGFGLGKKLQQKH
PEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLL 138

  Fly   144 QTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKSKSE 208
            |. |...||.||.|.:|||.|||:|.|:|.::||:..|::||:||:|:||:.||.|:::...:.:
Human   139 QI-QASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGK 202

  Fly   209 -TGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKDGPLALYR 272
             ..::|....:.|||:||:..|.:.:|.||||||.|:||.|.|.:|.|.|.::||..:|..:||:
Human   203 RVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYK 267

  Fly   273 GVTPIMLRAFPANAACFFGIELANKFFNIVAPN 305
            |...:|:||||||||||.|.|:|.||.|...||
Human   268 GFNAVMIRAFPANAACFLGFEVAMKFLNWATPN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 56/92 (61%)
Mito_carr 112..202 CDD:395101 50/89 (56%)
Mito_carr 210..299 CDD:395101 43/88 (49%)
SLC25A20NP_000378.1 Mito_carr 6..103 CDD:395101 57/93 (61%)
Solcar 1 8..99 54/89 (61%)
Mito_carr 106..198 CDD:395101 50/92 (54%)
Solcar 2 108..196 50/88 (57%)
Mito_carr 205..294 CDD:395101 43/88 (49%)
Solcar 3 207..293 42/85 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I5022
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H331
Inparanoid 1 1.050 332 1.000 Inparanoid score I2432
Isobase 1 0.950 - 0 Normalized mean entropy S1045
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 1 1.000 - - otm40359
orthoMCL 1 0.900 - - OOG6_102800
Panther 1 1.100 - - LDO PTHR45624
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 1 1.000 - - X2353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.820

Return to query results.
Submit another query.