DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and slc25a20l

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_031746643.1 Gene:slc25a20l / 779503 XenbaseID:XB-GENE-5944561 Length:303 Species:Xenopus tropicalis


Alignment Length:298 Identity:147/298 - (49%)
Similarity:201/298 - (67%) Gaps:3/298 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 STERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEG 72
            |..:.|.|||:.:.||.||:|.:|:|.|||||||.|||.|.||.|:||||..|..|.:|.|..||
 Frog     5 SKTQTAPPVKNVIAGGIGGMCLILAGQPLDTIKVNLQTQPSPALGQQPLYNSTLHCFSKIIAREG 69

  Fly    73 VRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGE 137
            :||||:||.|||..|.||.::.|.|:.|||.|||...|:.|...|:||||..:||.||::|||||
 Frog    70 IRGLYRGMGAPLAVVTPIMSITFVGFGLGKSLQQTSPDSILRSWQVFVAGMLAGLSSTVLMAPGE 134

  Fly   138 RIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDV 202
            |||.|||. |....::.:.|.:|||..||:|.|:|.:::|:..|::||:|:.|:||:.||.:::.
 Frog   135 RIKCLLQV-QSVTLKKTFQGPLDCAQTLYRELGIRGLYRGTLLTLIRDVPSTGVYFMSYEWMKEK 198

  Fly   203 AK-SKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKDG 266
            .: .:|...::.....:.|||||||..|::.:||||||||.|:|||..||: |..|.::::..:|
 Frog   199 MRGERSSARELRATEILLAGGVAGMCNWLVAIPADVLKSRFQTAPENHYKN-ILEVLREVLHSEG 262

  Fly   267 PLALYRGVTPIMLRAFPANAACFFGIELANKFFNIVAP 304
            |..||||.|..||||||||||||.|.|.:..|.|.:.|
 Frog   263 PCGLYRGFTAAMLRAFPANAACFLGFEASMSFLNWLIP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 54/94 (57%)
Mito_carr 112..202 CDD:395101 41/89 (46%)
Mito_carr 210..299 CDD:395101 45/88 (51%)
slc25a20lXP_031746643.1 Mito_carr 8..105 CDD:395101 55/96 (57%)
Mito_carr 110..201 CDD:395101 41/91 (45%)
Mito_carr 215..295 CDD:395101 45/80 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6230
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 351 1.000 Inparanoid score I2219
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 1 1.000 - - mtm9345
Panther 1 1.100 - - O PTHR45624
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2353
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.