DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and slc25a47a

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001038779.1 Gene:slc25a47a / 724009 ZFINID:ZDB-GENE-060616-266 Length:294 Species:Danio rerio


Alignment Length:296 Identity:100/296 - (33%)
Similarity:147/296 - (49%) Gaps:37/296 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAP 83
            ||.|.|||.|.|..|:||||:|||:||        |..:.|.:.|...||:.|||.|.:|||..|
Zfish     6 FLAGSFGGACGVAVGYPLDTVKVRIQT--------QKQFTGIWQCIVLTIRKEGVHGFFKGMFLP 62

  Fly    84 LTGVAPIFAMCFAGYALGKRLQ-----QRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLL 143
            :|.::...::.|..|.  ..||     ::.|:.||   .:|::|...|:....:|:||:.:||.|
Zfish    63 ITTISMTSSVVFGTYR--NCLQA
LSYIRKAENTKL---DVFMSGLAGGVAQVSVMSPGDIVKVRL 122

  Fly   144 QTQQGQ--------GGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQ 200
            |.|...        ..:.||:|.|.|...:.:|.||..:::|:....|||.|:...|||.|..| 
Zfish   123 QCQTESRHSVNPKYSVKPKYSGPIHCLLSICREQGLSGLYRGALPLALRDGPSFATYFLTYHTL- 186

  Fly   201 DVAKSKSETGQISTASTI--FAGGVAGMAYWILGMPADVLKSRLQ-SAPEGTYKHGIRSVFKDLI 262
              ....:..||.....|:  .:||||||:.|.:|.|.||:|:||| ....|..::  |.:...|.
Zfish   187 --CAR
LTPDGQKEPEWTVVLLSGGVAGMSGWAVGTPMDVIKARLQMDGVRGQRRY--RGLLHCLT 247

  Fly   263 V---KDGPLALYRGVTPIMLRAFPANAACFFGIELA 295
            |   .:|....:|.:....|||||.|...|...|::
Zfish   248 VTTRTEGLGVFFRSLGINCLRAFPVNMVVFAVYEVS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 36/92 (39%)
Mito_carr 112..202 CDD:395101 31/97 (32%)
Mito_carr 210..299 CDD:395101 32/92 (35%)
slc25a47aNP_001038779.1 Mito_carr 3..77 CDD:278578 33/78 (42%)
Solcar 1 4..83 35/86 (41%)
Solcar 2 95..189 30/99 (30%)
Mito_carr 98..183 CDD:278578 27/84 (32%)
Mito_carr 196..288 CDD:278578 30/90 (33%)
Solcar 3 198..286 30/88 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.