DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Slc25a45

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_008758401.1 Gene:Slc25a45 / 689625 RGDID:1589953 Length:292 Species:Rattus norvegicus


Alignment Length:296 Identity:110/296 - (37%)
Similarity:151/296 - (51%) Gaps:31/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYK 78
            |..:|..||...|...::.|||.||:||||||        |..|:|..||..||.::|.|.|.:|
  Rat     5 NSGESRQTGSVPGAVGLVLGHPFDTVKVRLQT--------QNTYQGIVDCVVKTYRHESVLGFFK 61

  Fly    79 GMSAPLTGVAPIFAMCFAGY-----ALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGER 138
            |||.|:..||.:.::.|..|     ||.....|.......:|..||:||...||.....:||.:.
  Rat    62 GMSFPIASVALVNSVLFGVYSNTLLALTATSHQERRAQPPSYTNIFIAGCTGGLLQAYCLAPFDL 126

  Fly   139 IKVLLQTQ-----QGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEA 198
            |||.||.|     |......:|.|.:.||..:.||.|.:.:|:||.|.:|||.|..|:||:.||.
  Rat   127 IKVRLQNQTEPRMQIGSSTPRYRGPVHCAASILKEEGPQGLFRGSWALVLRDTPTLGMYFVTYEG 191

  Fly   199 LQDVAKSKSETGQ-ISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHG-----IRSV 257
            |   .:..:..|| .|:|:.:.|||.||:|.||...|.||:|||:|.......|:|     :.|.
  Rat   192 L---CRQYTPEGQNPSSATVLVAGGFAGIASWITATPFDVIKSRMQMDGLKGRKYGGMLDCMASS 253

  Fly   258 FKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIE 293
            |:    ::|....::|:|....||||.|||.|...|
  Rat   254 FR----QEGIGVFFKGMTLNSARAFPVNAATFLSYE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 37/97 (38%)
Mito_carr 112..202 CDD:395101 37/94 (39%)
Mito_carr 210..299 CDD:395101 35/90 (39%)
Slc25a45XP_008758401.1 Mito_carr 13..81 CDD:278578 31/75 (41%)
Mito_carr 99..190 CDD:278578 34/90 (38%)
Mito_carr 201..292 CDD:278578 34/89 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.