DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and slc25a29

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001025408.1 Gene:slc25a29 / 569608 ZFINID:ZDB-GENE-050913-70 Length:305 Species:Danio rerio


Alignment Length:296 Identity:112/296 - (37%)
Similarity:158/296 - (53%) Gaps:25/296 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAP 83
            ||.|..||...||.|||.||:|||||..    ...:|||||||.|....|:.|.|.|||||:.:|
Zfish     3 FLAGCIGGAAGVLVGHPFDTVKVRLQVQ----SVYKPLYRGTFHCFQSIIRQESVLGLYKGIGSP 63

  Fly    84 LTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQG 148
            :.|:..|.|:.|.  ..|..:::.|||..|..   |:||:.:|....:|..|.|..|..:| .||
Zfish    64 MMGLTFINAIVFG--VQGNAMRRLGEDTPLNQ---FLAGAAAGSIQCVICCPMELAKTRMQ-MQG 122

  Fly   149 QGGERK------YNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEAL-QDVAKSK 206
            . ||:|      |...:||..::|:..|||.|.:|...|::|:.|..|:|||.|:.| :.:....
Zfish   123 T-GEKKSSSRKVYKNSLDCLARIYQREGLRGVNRGMVTTLIRETPGFGVYFLAYDLLTRSLGCEP 186

  Fly   207 SETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQS-APEGTYKH-GIRSVFKDLIVKDGPLA 269
            .:...|  ...:||||::|:|.|:...|.||:|||||: ...|.|:: .|....:..|.::|...
Zfish   187 DDPYMI--PKLLFAGGMSGIASWLSTYPVDVIKSRLQADGVGGKYQYSSIMDCTRKSIQREGFRV 249

  Fly   270 LYRGVTPIMLRAFPANAACFFGIELANKFFNIVAPN 305
            ..||:|..:|||||.|||.|..:.|   |...|.|:
Zfish   250 FTRGLTSTLLRAFPVNAATFATVTL---FLLYVRPD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 39/87 (45%)
Mito_carr 112..202 CDD:395101 33/96 (34%)
Mito_carr 210..299 CDD:395101 34/90 (38%)
slc25a29NP_001025408.1 PTZ00169 2..262 CDD:240302 101/271 (37%)
Mito_carr 2..77 CDD:278578 38/79 (48%)
Mito_carr 86..183 CDD:278578 36/101 (36%)
Mito_carr 192..271 CDD:278578 33/80 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.