DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and slc25a15b

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001121816.1 Gene:slc25a15b / 565335 ZFINID:ZDB-GENE-060526-35 Length:307 Species:Danio rerio


Alignment Length:292 Identity:93/292 - (31%)
Similarity:139/292 - (47%) Gaps:24/292 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMS-APLT 85
            |..||...|.||.||||.||::||.|       .||||..||...|.:..|:||||:|.: |.:.
Zfish    16 GAIGGAACVFSGQPLDTAKVKMQTFP-------TLYRGFVDCFVSTYRQVGLRGLYQGTTPALMA 73

  Fly    86 GVA--PIFAMCFAGYA--LGKRLQQRGEDAKLTYPQI-----FVAGSFSGLFSTLIMAPGERIKV 141
            .:|  .:..||: |:.  :.:.:..:|:.|:|.:.|.     ..|||.:.:||:|::.|.|.:|.
Zfish    74 NIAENSVLFMCY-GFCQEVVRFVSGQGKGAELRHVQFNDMQKACAGSVASVFSSLVLCPTELVKC 137

  Fly   142 LLQTQQGQGGERK----YNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDV 202
            .||.........|    .|.:......:....|....|:|...|:.|::|....:|..||..:.:
Zfish   138 RLQAMHEMASSGKITQSQNTVWSVMKSIMHNDGPAGFFQGLTTTIAREVPGYFCFFGAYELCRSL 202

  Fly   203 AKSKSETGQ--ISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKD 265
            .......|:  |..|..:|:||..|...|::..|.|.:|||:|.......:.|....|..:...:
Zfish   203 FADYMHCGKDDIGVAPIVFSGGFGGACLWLVVYPMDCVKSRIQVMSMTGRQSGFFKTFMHIFRTE 267

  Fly   266 GPLALYRGVTPIMLRAFPANAACFFGIELANK 297
            |..|||.|:||.|:|.||||.|.|.|.|.:.|
Zfish   268 GVRALYSGLTPTMIRTFPANGALFLGYEASRK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 33/89 (37%)
Mito_carr 112..202 CDD:395101 24/98 (24%)
Mito_carr 210..299 CDD:395101 34/90 (38%)
slc25a15bNP_001121816.1 Mito_carr 9..96 CDD:278578 33/87 (38%)
PTZ00169 10..302 CDD:240302 93/292 (32%)
Mito_carr 112..206 CDD:278578 22/93 (24%)
Mito_carr 220..302 CDD:278578 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.