DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and CG1907

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:331 Identity:82/331 - (24%)
Similarity:133/331 - (40%) Gaps:57/331 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTTENVSTERKA---NPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFD 62
            |:.|......:||   |.:| ||.||..|:...:...|||.:|.|:| :.....|::. ||.:..
  Fly     1 MSATSVQEAPKKAVATNAIK-FLFGGLSGMGATMVVQPLDLVKTRMQ-ISGAGSGKKE-YRSSLH 62

  Fly    63 CAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTY------------ 115
            |....:..||...||:|:.|.|        :..|.|..|:.       ...||            
  Fly    63 CIQTIVSKEGPLALYQGIGAAL--------LRQATYTTGRL-------GMYTYLNDLFREKFQRS 112

  Fly   116 PQI---FVAGSFSGLFSTLIMAPGERIKVLLQTQQGQ---GGERKYNGMIDCAGKLYKEGGLRSV 174
            |.|   ...|:.:|.....|..|.| :.::..|..|:   ...|.|..:.:...::.:|.||.::
  Fly   113 PGITDSMAMGTIAGACGAFIGTPAE-VALVRMTSDGRLPVAERRNYTNVANALARITREEGLTAL 176

  Fly   175 FKGSCATMLRDLPANGLYFLVYEALQDVAKSKSETGQISTASTI----FAGGVAGMAYWILGMPA 235
            ::||..|:.|.:..|......|...    |:....|.:.....|    .|..::|:...|..||.
  Fly   177 WRGSLPTVGRAMVVNMTQLASYSQF----KTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPL 237

  Fly   236 DVLKSRLQS------APEGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIEL 294
            |:.|:|:|:      .||  |: |...|...:..::|..||::|.||...|..|.....|..:|.
  Fly   238 DIAKTRIQNMKMVDGKPE--YR-GTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQ 299

  Fly   295 ANKFFN 300
            .|:.:|
  Fly   300 LNQGYN 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 29/97 (30%)
Mito_carr 112..202 CDD:395101 22/107 (21%)
Mito_carr 210..299 CDD:395101 27/98 (28%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 29/110 (26%)
Mito_carr 118..207 CDD:278578 19/93 (20%)
Mito_carr 219..307 CDD:278578 26/90 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441742
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.