DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and CG5646

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_651568.1 Gene:CG5646 / 43311 FlyBaseID:FBgn0039525 Length:303 Species:Drosophila melanogaster


Alignment Length:301 Identity:91/301 - (30%)
Similarity:136/301 - (45%) Gaps:42/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQ-TMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSA 82
            |:.|.|||.|.||..||||||||..| :........|.:|.          :|.||.|.|:||..
  Fly     9 FVAGCFGGACGVLVAHPLDTIKVWQQASNSSVVTAIQQIYS----------RNNGVNGFYRGMFF 63

  Fly    83 PLTGVAPIFAMCFAGYALGKRLQQRG-------EDAKLTYPQIFVAGSFSGLFSTLIMAPGERIK 140
            |......|.::.|..|  |..|:|..       :..:|.|..:|:|||.:|...:.|..|.|.||
  Fly    64 PFISTGAINSLLFGIY
--GNHLRQLRKVCHSDYQREQLEYHNMFLAGSVAGFVQSFIACPMELIK 126

  Fly   141 VLLQTQQGQG----GERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQD 201
            |.|||.....    |:|:  .......::.|..|:..:::|....|.||:...|:|.|.|....|
  Fly   127 VRLQTATYYSDYLYGQRR--TAFGTFKRILKTDGISGLYRGLLPMMCRDVLPYGIYMLAYRQGVD 189

  Fly   202 V---------AKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYK---HGI 254
            .         .:|:|:...::...|..||..||:..|:..:|.||:|:.:|:.....|:   |.:
  Fly   190 YM
DRRDFVRRRRSQSDGSSVNLLVTTLAGAWAGVISWVCVIPFDVVKTLMQADENHKYRGIFHCV 254

  Fly   255 RSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELA 295
            |..::..    |..:::||...::.||.|.|||.|.|.|.|
  Fly   255 RVQYRAY----GWRSIFRGSWMLVARAVPFNAATFLGYEYA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 32/88 (36%)
Mito_carr 112..202 CDD:395101 28/93 (30%)
Mito_carr 210..299 CDD:395101 27/89 (30%)
CG5646NP_651568.1 Mito_carr 5..79 CDD:395101 29/79 (37%)
Mito_carr 97..191 CDD:395101 29/95 (31%)
Mito_carr 207..294 CDD:395101 27/89 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0758
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45624
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.