DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and CG4743

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:292 Identity:79/292 - (27%)
Similarity:128/292 - (43%) Gaps:33/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VSTERKANPVKSF---LTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTI 68
            :..:...|.:|.|   :.||..|:...::..|:||:|.|||:       |...:|.         
  Fly    16 IKMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQS-------ELGFWRA--------- 64

  Fly    69 KNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIM 133
              .|.||:|||::....|.||..|:.|..|..||:........|.:......|.|.:.:.:.||.
  Fly    65 --GGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPYVHMAAASAAEVLACLIR 127

  Fly   134 APGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGL-RSVFKGSCATMLRDLPANGLYFLVYE 197
            .|.|..|...||.||    .|.:| :....:.|:..|| |.:::|..:|::|::|.:.:.|.::|
  Fly   128 VPVEIAKQRSQTLQG----NKQSG-LQILLRAYRTEGLKRGLYRGFGSTIMREIPFSLIQFPLWE 187

  Fly   198 ALQDVAKSKSETGQISTA-STIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTY--KHGIRSVFK 259
            ..:  .:....||..||. |....|.|||.....|..|.||:|:|:..|...:.  :...|.:..
  Fly   188 YFK--LQWTPLTGFDSTPFSVALCGAVAGGISAGLTTPLDVVKTRIMLAERESLNRRRSARRILH 250

  Fly   260 DLIVKDGPLALYRGVTPIMLRAFPANAACFFG 291
            .:.::.|...|:.|..|.:| ......|.|||
  Fly   251 GIYLERGFSGLFAGFVPRVL-WITLGGAFFFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 29/97 (30%)
Mito_carr 112..202 CDD:395101 24/90 (27%)
Mito_carr 210..299 CDD:395101 25/85 (29%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 29/93 (31%)
PTZ00168 25..281 CDD:185494 76/281 (27%)
Mito_carr 199..291 CDD:278578 24/84 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441732
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.