DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and DPCoAC

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:283 Identity:69/283 - (24%)
Similarity:120/283 - (42%) Gaps:22/283 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTENVSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPL-YRGTFDCAAK 66
            ||.....::....|.|.::|...|........|||..|:..|..     .:.|. :|.:......
  Fly    60 TTVTPMRQKIDQVVISLISGAAAGALAKTVIAPLDRTKINFQIR-----NDVPFSFRASLRYLQN 119

  Fly    67 TIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTL 131
            |..||||..|::|.||.:..:.|..|:.|..:...:|:....:|...|..:.|:|||.:|:.|..
  Fly   120 TYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQS 184

  Fly   132 IMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVY 196
            :..|.:..:..:.......|   |..:.....|::.|.|.|::|:|..||:|..:|..|..|..|
  Fly   185 LTYPLDLARARMAVTDRYTG---YRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTY 246

  Fly   197 EALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIR------ 255
            |.|:..........:.:|..::..|..||.|......|.|:::.|:|:....| ..|.|      
  Fly   247 ETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNT-AGGDRYPTILE 310

  Fly   256 ---SVFKDLIVKDGPLALYRGVT 275
               .::::..||:|   .|:|::
  Fly   311 TLVKIYREEGVKNG---FYKGLS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 24/95 (25%)
Mito_carr 112..202 CDD:395101 25/89 (28%)
Mito_carr 210..299 CDD:395101 17/75 (23%)
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 24/91 (26%)
Mito_carr 169..251 CDD:278578 24/84 (29%)
Mito_carr 279..356 CDD:278578 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.