DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Dic1

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:295 Identity:78/295 - (26%)
Similarity:117/295 - (39%) Gaps:50/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FGGICNV---LSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLT 85
            |||:.:|   :..||||.|||.|||        |..:........|..:.:||...|.|:||.:.
  Fly    12 FGGLASVGAAMVTHPLDLIKVTLQT--------QQGHLSVAQLIPKLAREQGVLVFYNGLSASVL 68

  Fly    86 GVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQT----- 145
            .........|..|..||:........    .::.:||: |||...::..|.:.:.|.:|.     
  Fly    69 RQLTYSTARFGVYEAGKKYVNTDSFG----GKVALAGA-SGLVGGIVGTPADMVNVRMQNDVKLP 128

  Fly   146 -QQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDL----------PANGLYFLVYEAL 199
             ||    .|.||...|...::|::.|.:.:|.|:.|...|.:          ....:|.|.....
  Fly   129 PQQ----RRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYF 189

  Fly   200 QDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVK 264
            ||           :..:...|..|||.....|..|.||||:|..:|..|.: :|:..:.|. ..|
  Fly   190 QD-----------NLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEF-NGLWDIVKH-TAK 241

  Fly   265 DGPLALYRGVTPIMLRAFPANAACFFGIE-LANKF 298
            .|||..::|..|..:|..|.....|..:| |..||
  Fly   242 LGPLGFFKGYVPAFVRLGPHTIITFVFLEQLRLKF 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 26/85 (31%)
Mito_carr 112..202 CDD:395101 23/105 (22%)
Mito_carr 210..299 CDD:395101 28/90 (31%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 26/87 (30%)
PTZ00169 13..273 CDD:240302 74/289 (26%)
Mito_carr 89..184 CDD:278578 21/103 (20%)
Mito_carr 189..278 CDD:278578 30/101 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.