DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and GC1

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:287 Identity:83/287 - (28%)
Similarity:128/287 - (44%) Gaps:24/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPL 84
            :.||..||..|....|||.:|.|||.. :..|..:.:|...|||..||.|.||..|:|:|....:
  Fly    26 INGGIAGIIGVTCVFPLDLVKTRLQNQ-QIGPNGERMYNSMFDCFRKTYKAEGYFGMYRGSGVNI 89

  Fly    85 TGVAPIFAMCFAG--YALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQ 147
            ..:.|..|:....  |.   |.:...:|.||......|||..:|.|..::..|.|.:|:.:|...
  Fly    90 LLITPEKAIKLTANDYF---RHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAG 151

  Fly   148 GQGGERKYNG-------MIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKS 205
            ......|..|       ....|.:|.|:.|:..::||..||.|||:..:.:||.::..|.|:...
  Fly   152 RVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLFATLNDLGPR 216

  Fly   206 KSE-TGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAP----EGTYKHGIRSVFKDLIVKD 265
            ::: :|:.....:..||..||....:...|.||:|:|||:..    |..:| ||.......:..:
  Fly   217 RNDGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQAIKKADGEKEFK-GISDCITKTLKHE 280

  Fly   266 GPLALYRGVTPIMLRAFPANAACFFGI 292
            ||.|.::|....|:...|     .|||
  Fly   281 GPTAFFKGGLCRMIVIAP-----LFGI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 29/88 (33%)
Mito_carr 112..202 CDD:395101 27/96 (28%)
Mito_carr 210..299 CDD:395101 25/87 (29%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 25/80 (31%)
Mito_carr 115..213 CDD:278578 27/97 (28%)
Mito_carr 226..307 CDD:278578 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.