DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Dic4

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:291 Identity:62/291 - (21%)
Similarity:116/291 - (39%) Gaps:34/291 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLTG 86
            |||..:|...:..|:|.:|..:|.        |...|.......:....:|..|.|.|.||.:..
  Fly    26 GGFASMCVAFAVAPIDIVKTHMQI--------QRQKRSILGTVKRIHSLKGYLGFYDGFSAAILR 82

  Fly    87 VAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQG- 150
            ......:.|..|..||:::....|   :|....:.|..:|...:....|.:.|.|.:||...:. 
  Fly    83 QMTSTNIHFIVYDTGKKMEYVDRD---SYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMKEPP 144

  Fly   151 -GERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQ-DVAKSKSETGQI- 212
             ..|.|..:.|...::.||.|.::::||....:.:...:.......|:.:: :|.|:.|....: 
  Fly   145 YKRRNYKHVFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISVNDGLP 209

  Fly   213 -----STASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLI--VKDGPLAL 270
                 |..::|.:..:.        .|.||:::.:.::..|.:    |:||:..:  ::.|.:..
  Fly   210 LHFLTSLGTSIISSAIT--------HPLDVVRTIMMNSRPGEF----RTVFQASVHMMRFGVMGP 262

  Fly   271 YRGVTPIMLRAFPANAACFFGIELANKFFNI 301
            |||..|.::|..||....|...|.....|.|
  Fly   263 YRGFVPTIVRKAPATTLLFVLYEQLRLHFGI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 20/84 (24%)
Mito_carr 112..202 CDD:395101 17/92 (18%)
Mito_carr 210..299 CDD:395101 19/96 (20%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 60/284 (21%)
Mito_carr 26..100 CDD:278578 20/81 (25%)
Mito_carr 104..201 CDD:278578 19/99 (19%)
Mito_carr 211..292 CDD:278578 19/92 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.