DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and SCaMC

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:308 Identity:82/308 - (26%)
Similarity:134/308 - (43%) Gaps:37/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMS 81
            :..:.||..|..:.....|||.|||.||.        |....|..:|....:...|.|.:::|..
  Fly   287 RHLVAGGIAGAVSRTCTAPLDRIKVYLQV--------QTQRMGISECMHIMLNEGGSRSMWRGNG 343

  Fly    82 APLTGVAPIFAMCFAGYALGKRLQQRGEDA--KLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQ 144
            ..:..:||..|..||.|...||| .||:|.  :::..:.|.||:.:|..|..|:.|.|.:|..|.
  Fly   344 INVLKIAPETAFKFAAYEQMKRL-IRGD
DGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLA 407

  Fly   145 TQQ-GQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEAL-QDVAKSKS 207
            .:: ||     |.|:.|.|.|:||:.|:||.::|....:|..||..|:...|||.| :....:..
  Fly   408 LRRTGQ-----YAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYETLKRRYIANHD 467

  Fly   208 ETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIR----------------- 255
            ...|.|....:..|..:.....:...|..::::|||:....|..:..|                 
  Fly   468 NNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEET 532

  Fly   256 --SVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANKFFNI 301
              .:|:.::.::|...||||:||..|:..||.:..:...|..::...|
  Fly   533 MTGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALGI 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 26/89 (29%)
Mito_carr 112..202 CDD:395101 31/91 (34%)
Mito_carr 210..299 CDD:395101 21/107 (20%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 27/91 (30%)
Mito_carr 375..463 CDD:278578 31/92 (34%)
Mito_carr 470..581 CDD:278578 22/111 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441762
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.