DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and sea

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:290 Identity:79/290 - (27%)
Similarity:127/290 - (43%) Gaps:11/290 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGM 80
            :|..:.||..|...:...:|.:.:|.:||...:   |....|.|.|||..||:...|..|||:|:
  Fly    34 LKGIVAGGITGGIEICITYPTEYVKTQLQLDEK---GAAKKYNGIFDCVKKTVGERGFLGLYRGL 95

  Fly    81 SAPLTGVAPIFAMCFAGYALGK--RLQQRGEDAKLTYPQIFVAGSFSGLFSTLI-MAPGERIKVL 142
            |..:.|..|..|..|..:...|  .:..||:   |:.....:.|..:|:...:: :.|.|.|||.
  Fly    96 SVLVYGSIPKSAARFGAFEFLKSNAVDSRGQ---LSNSGKLLCGLGAGVCEAIVAVTPMETIKVK 157

  Fly   143 LQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKSKS 207
            ....| :.|..|:.|.....|::.|..|:..::||...|:|:......:.|.|.|:|:|:.|...
  Fly   158 FINDQ-RSGNPKFRGFAHGVGQIIKSEGISGIYKGLTPTILKQGSNQAIRFFVLESLKDLYKGDD 221

  Fly   208 ETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLIVKDGPLALYR 272
            .|..:........|.:||.|......|.||:|:|:|......||:...... :::..:||.|.|:
  Fly   222 HTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQGLEASKYKNTAHCAV-EILKNEGPAAFYK 285

  Fly   273 GVTPIMLRAFPANAACFFGIELANKFFNIV 302
            |..|.:.|.....|..|...:.....||.|
  Fly   286 GTVPRLGRVCLDVAITFMIYDSFMDLFNKV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 27/92 (29%)
Mito_carr 112..202 CDD:395101 23/90 (26%)
Mito_carr 210..299 CDD:395101 21/88 (24%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 75/275 (27%)
Mito_carr 34..117 CDD:278578 26/85 (31%)
Mito_carr 125..220 CDD:278578 26/98 (27%)
Mito_carr 235..314 CDD:278578 22/79 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.