DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Mpcp1

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster


Alignment Length:302 Identity:80/302 - (26%)
Similarity:131/302 - (43%) Gaps:37/302 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGH----PLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKG 79
            ||..|.|||.:..|.|    |||.:|.|||..|..       |:..|.....::..||||||.||
  Fly    75 FLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAK-------YKSVFTGFRISLAEEGVRGLAKG 132

  Fly    80 MSAPLTGVAPIFAMC-FAGYALGKRL--QQRGEDAKLTY-PQIFVAGSFSG-LFSTLIMAPGERI 139
            .:....|.: :..:| |..|.:.|::  ...||:....| ..:::|.|.|. .|:.:.:||.|..
  Fly   133 WAPTFIGYS-MQGLCKFGLYEVFKKVYGD
AIGEENAFLYRTGLYLAASASAEFFADIALAPMEAA 196

  Fly   140 KVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQD--- 201
            ||.:||..|..     ..:.:...|:..:.|:.:.:||.....:|.:|...:.|..:|...:   
  Fly   197 KVKIQTTPGFA-----KTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLY 256

  Fly   202 ---VAKSKSE-TGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFKDLI 262
               |.|.::: |.......|..||.:||:...|:..|||.:.|:|..|      .|..::  |:.
  Fly   257 KY
VVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQA------KGASAL--DVA 313

  Fly   263 VKDGPLALYRGVTPIMLRAFPANAACFFGIELANKFFNIVAP 304
            .:.|...|:.|:.|.::......||.:|..:....|..:..|
  Fly   314 KQLGWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVFLRMPRP 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 31/94 (33%)
Mito_carr 112..202 CDD:395101 21/97 (22%)
Mito_carr 210..299 CDD:395101 21/88 (24%)
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 31/92 (34%)
Mito_carr <188..258 CDD:278578 16/74 (22%)
Mito_carr 273..350 CDD:278578 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.