DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and CG18324

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:304 Identity:71/304 - (23%)
Similarity:117/304 - (38%) Gaps:47/304 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTF--------DCAAKTIKNEGVRG 75
            |:.||...:..|:..:|:|.:|.|:|.....|.      |||:        ....:.:.|:|:..
  Fly     6 FVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAA------RGTYVKPYRHLPQAMLQIVLNDGLLA 64

  Fly    76 LYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQ------IFVAGSF----SGLFST 130
            |.||:       ||  |:|:.......||.......:|.|.|      .|..|.|    .|...|
  Fly    65 LEKGL-------AP--ALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGT 120

  Fly   131 LIMAPGERIKVLLQTQQGQ----GGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGL 191
            ...:|...||.....|..|    |.:.|:..|:|....:|:..|:...::.:..::.|.|.|:.:
  Fly   121 YFASPFYMIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSV 185

  Fly   192 YFLVYEALQDVAKSKSETGQIS--TASTIFAGGVAGMAYWILGMPADVLKSRLQSAP-----EGT 249
            ....:...:.:.|.|   |.|:  ...:..||..:|....:...|.|||.:|:.:.|     .|.
  Fly   186 QIGTFPKAKSLLKDK---GWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGL 247

  Fly   250 YKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIE 293
            ...|:...|..:...:|...:|:|..||..|:.|.....|...|
  Fly   248 MYKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 24/95 (25%)
Mito_carr 112..202 CDD:395101 22/103 (21%)
Mito_carr 210..299 CDD:395101 23/91 (25%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 24/95 (25%)
PTZ00169 5..293 CDD:240302 71/304 (23%)
Mito_carr 101..201 CDD:278578 21/102 (21%)
Mito_carr 204..296 CDD:278578 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.