DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and CG8323

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:312 Identity:72/312 - (23%)
Similarity:128/312 - (41%) Gaps:45/312 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGE--------QPLYRGTFDCAAKTIKNEGVRG 75
            |:.||...:......:|::.||.|:|..     ||        :| |:|..:......||:|:.|
  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQ-----GELAARGTYVEP-YKGIVNAFITVAKNDGITG 64

  Fly    76 LYKGMSAPL--TGVAPIFAMCFAGYALGKRL--QQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPG 136
            |.||::..|  ..:...|.:.....|:.:|.  .::||   ::|....:.|:..|:......:|.
  Fly    65 LQKGLAPALYFQFIINSFRLSIYSEAMERRWMHNRKGE---VSYGMGLLWGAIGGVVGCYFSSPF 126

  Fly   137 ERIKVLLQTQQGQ----GGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYE 197
            ..||..||:|..:    |.:..:..|.|...::|...|:|.:::||.|.:.|....:|.....: 
  Fly   127 FLIKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATF- 190

  Fly   198 ALQDVAKSKSETGQIS-----TASTIFAGGVAGMAYWILGMPADVLKSRL-----QSAPEGTYKH 252
                 .|:|:...|..     |.::..||.:||....:...|.||:.:||     .:...|....
  Fly   191 -----GKTKALLVQYDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYR 250

  Fly   253 GIRSVFKDLIVKDGPLALYRGVTPIMLRAFPAN--AACFFG--IELANKFFN 300
            |....|..::..:|...:|:|.....||..|.:  ...||.  :.:..|:.|
  Fly   251 GWLDCFVKILRSEGVYGMYKGFWANYLRIAPHSTLVLLFFDELVAVRTKYSN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 24/99 (24%)
Mito_carr 112..202 CDD:395101 20/93 (22%)
Mito_carr 210..299 CDD:395101 23/102 (23%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 22/86 (26%)
PTZ00169 5..293 CDD:240302 70/301 (23%)
Mito_carr 101..200 CDD:278578 24/107 (22%)
Mito_carr 206..301 CDD:278578 22/94 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441286
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.