DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Ucp4B

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_608977.1 Gene:Ucp4B / 33833 FlyBaseID:FBgn0031758 Length:337 Species:Drosophila melanogaster


Alignment Length:329 Identity:87/329 - (26%)
Similarity:149/329 - (45%) Gaps:58/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ENVSTERKANPVKSFLTGGFGGICNV-LSGHPLDTIKVRLQTMPRPAP--GEQPLYRGTFDCAAK 66
            |.:.|.:|..||:.:|| .|...|:. :.|:|.|..|.|:|.....|.  |::..|||....|..
  Fly    26 EYLVTNKKTPPVELYLT-AFASACSAEIVGYPFDMCKTRMQIQGEIASRVGQKAKYRGLLATAMG 89

  Fly    67 TIKNEGVRGLYKGMSAPL------TGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQI-----FV 120
            .::.||:..||.|:||.|      :|:    .|....| :.:::....||.:   ||:     .:
  Fly    90 IVREEGLLKLYGGISAMLFRHSLFSGI----KMLTYDY-MREKMIVPDEDGR---PQLSFLGSCI 146

  Fly   121 AGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNG-------MIDCAGKLYKEGGLRSVFKG- 177
            :|..:|..::::..|.|.||:.:|.:    |:|:..|       ::.....:|:.||:..::|| 
  Fly   147 SGVLAGATASVLTNPTELIKIQMQME----GQRRLRGEPPRIHNVLQALTSIYRTGGVVGLWKGT 207

  Fly   178 ------SCATMLRDLPANGL--YFLVYEALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMP 234
                  |....:.|:.....  .||:.|.  |:..::..  |...|.|      ||:|..||.:|
  Fly   208 VPNTWRSALVTIGDVSCYDFCKRFLIAEF--DLVDNREV--QFVAAMT------AGVADAILSLP 262

  Fly   235 ADVLKSRLQSAP-----EGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIEL 294
            |||:|||:.:.|     .|.:..|.......|:.::|.||:|:|..|..:|..||:...:...|.
  Fly   263 ADVVKSRIMNQPTDEQGRGIHYKGSLDCLSRLVREEGFLAMYKGFIPYWMRVGPASVVFWMTFEQ 327

  Fly   295 ANKF 298
            ..:|
  Fly   328 IRRF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 30/103 (29%)
Mito_carr 112..202 CDD:395101 22/110 (20%)
Mito_carr 210..299 CDD:395101 30/94 (32%)
Ucp4BNP_608977.1 PTZ00169 32..306 CDD:240302 78/296 (26%)
Mito_carr 32..129 CDD:278578 30/102 (29%)
Mito_carr 138..233 CDD:278578 19/98 (19%)
Mito_carr 246..331 CDD:278578 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.