DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Rim2

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:384 Identity:83/384 - (21%)
Similarity:138/384 - (35%) Gaps:122/384 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPR--------------PAPGEQ------ 54
            :..|:.:...:.||..|....:...||:.:|.|||:...              ||.|.|      
  Fly     3 QNTADTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELLRP 67

  Fly    55 --------------------------------------PLYRGTFDCAAKTIKNEGVRGLYKGMS 81
                                                  |.......|....::|||.|.|:||:.
  Fly    68 EQRRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSMSIVQCLRHIVQNEGPRALFKGLG 132

  Fly    82 APLTGVAPIFAMCFAGYALGKR-LQQRG---EDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVL 142
            ..|.||||..|:.|..|:..|. |...|   .|:.|.:   .::.:.:|..|:....|...:|..
  Fly   133 PNLVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSPLVH---IMSAASAGFVSSTATNPIWFVKTR 194

  Fly   143 LQTQQGQGGERKYNGMI-----DCAGKLYKEGGLRSVFK-------GSCATMLRDLPANGLYFLV 195
            :|..        ||..:     .|..::|.:||:.:.:|       |.|.||        ::|::
  Fly   195 MQLD--------YNSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGICETM--------VHFVI 243

  Fly   196 YEALQDVAKSK---------SET-GQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEG-- 248
            ||.:    |||         ::| |.......:.||.|:......:..|.:|.::||:.  ||  
  Fly   244 YEFI----KSKLLEQRNQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLRE--EGNK 302

  Fly   249 --TYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIE-----LANKFFN 300
              ::...:.:|:|:    :|...||||:...::|..|..|......|     |..:|.|
  Fly   303 YNSFWQTLHTVWKE----EGRAGLYRGLATQLVRQIPNTAIMMATYEAVVYVLTRRFNN 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 33/153 (22%)
Mito_carr 112..202 CDD:395101 20/101 (20%)
Mito_carr 210..299 CDD:395101 22/97 (23%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 31/147 (21%)
Mito_carr 163..253 CDD:278578 24/112 (21%)
Mito_carr 268..355 CDD:278578 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441766
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.