DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Slc25a48

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_808477.2 Gene:Slc25a48 / 328258 MGIID:2145373 Length:306 Species:Mus musculus


Alignment Length:302 Identity:95/302 - (31%)
Similarity:150/302 - (49%) Gaps:32/302 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGM 80
            ::.|:.|..||:.:|:.|:||||:|.|||.    ..|    |..||:|.....|.|.|.|.:|||
Mouse     6 LEDFVAGWIGGVASVIVGYPLDTVKTRLQA----GVG----YANTFNCIRMVYKRERVFGFFKGM 62

  Fly    81 SAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKL------TYPQIFVAGSFSGLFSTLIMAPGERI 139
            |.||..:|...::.|..::..:|...:....:|      :...:.:|...:|:.|..:..|.|.|
Mouse    63 SFPLASIAIYNSVVFGVFSNTQRFLSK
YRCGELEAGPGRSLSDLLLASMLTGVVSVGLGGPVELI 127

  Fly   140 KVLLQTQ-----QGQGGERK-----YNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFL 194
            |:.||.|     :...|.:.     |.|.:.|...:.:..||..:::|:.|.:|||:|....||:
Mouse   128 KIRLQMQTQPFREASHGLKSRAVAAYQGPVHCIATIVQMEGLTGLYRGASAMLLRDIPGYCFYFI 192

  Fly   195 VYEALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSVFK 259
            .|..|.:....::.||....|:.: |||:||...|....|.||:|||:|:  :|.|.:..|.|. 
Mouse   193 PYVFLSEWIT
PEACTGPSPYAAWL-AGGIAGAISWGTATPMDVVKSRIQA--DGVYLNKYRGVV- 253

  Fly   260 DLI----VKDGPLALYRGVTPIMLRAFPANAACFFGIELANK 297
            |.|    .::|....:||:|...:|.||.:||.|.|.||:.|
Mouse   254 DCISQSYQQEGFKVFFRGITVNAVRGFPMSAAMFLGYELSLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 32/90 (36%)
Mito_carr 112..202 CDD:395101 27/105 (26%)
Mito_carr 210..299 CDD:395101 35/92 (38%)
Slc25a48NP_808477.2 Solcar 1 3..86 31/87 (36%)
Mito_carr 6..89 CDD:365909 32/90 (36%)
Solcar 2 101..200 26/98 (27%)
Mito_carr 107..202 CDD:365909 26/94 (28%)
Mito_carr 209..299 CDD:365909 34/91 (37%)
Solcar 3 209..296 34/91 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.