DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Ant2

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:186 Identity:53/186 - (28%)
Similarity:89/186 - (47%) Gaps:18/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 FVAGSFSGLFSTLIMAPGERIKVLLQTQQGQ---GGERKYNGMIDCAGKLYKEGGLRSVFKGSCA 180
            |:.|..|...:...:||.||:|::||.|:..   ..:::|.|::||..::.||.|..|.::|:.|
  Fly    22 FMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGFSSFWRGNLA 86

  Fly   181 TMLRDLPANGLYFLVYEALQDVAKS-------KSETGQISTASTIFAGGVAGMAYWILGMPADVL 238
            .::|..|...|.|    |.:||.||       |.:......|..:.:||.||........|.|..
  Fly    87 NVIRYFPTQALNF----AFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVYPLDFA 147

  Fly   239 KSRLQS-APEGTYK--HGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFG 291
            ::||.: ..:|..:  :|:......:|..|||:.||||.. :.::......|.:||
  Fly   148 RTRLAADVGKGGNREFNGLIDCLMKVIKSDGPIGLYRGFI-VSVQGIVIYRAAYFG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101
Mito_carr 112..202 CDD:395101 26/85 (31%)
Mito_carr 210..299 CDD:395101 22/85 (26%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 53/186 (28%)
Mito_carr 17..111 CDD:278578 30/92 (33%)
Mito_carr 119..215 CDD:278578 22/85 (26%)
Mito_carr 218..307 CDD:278578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441755
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.