DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and CG1628

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:308 Identity:102/308 - (33%)
Similarity:147/308 - (47%) Gaps:56/308 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGV-RGLYKG-MS 81
            ||.|..||...|....||||:||:|||.|.       .|||..||...|.:.:|| ||||.| :.
  Fly   173 FLAGSLGGAAQVYVSQPLDTVKVKLQTFPE-------AYRGMLDCFLSTYRKDGVLRGLYAGSVP 230

  Fly    82 APLTGVAP---IFAM---C--FAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGER 138
            |....||.   :||.   |  |..:.:||  :..|:   ||..|...|||.:..||||.:.|.|.
  Fly   231 AVFANVAENSVLFAAYGGCQKFVAFCVGK--ETAGD---LTTVQNACAGSLAACFSTLTLCPTEL 290

  Fly   139 IKVLLQTQQGQGGERKYNGMIDCAGK------------LYKEGGLRSVFKGSCATMLRDLPANGL 191
            ||..||..      |:....::.|..            :::..|:|..::|..:|.||::|....
  Fly   291 IKCKLQAL------REMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMPGYFF 349

  Fly   192 YFLVYEALQDVAK----SKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKH 252
            :|..||..:::.:    ||.:.|.:   .|:.||.:.|:..|....||||:|||:|      .|:
  Fly   350 FFGSYEGTRELLRRDDQSKDDIGPL---RTMIAGAIGGVCLWTSTFPADVIKSRIQ------VKN 405

  Fly   253 GIRSVF---KDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANK 297
            ...|:|   .|::.::|.||||||:.|.:||..||.|..|...|...:
  Fly   406 LNESMFAVGADIVRREGVLALYRGLLPSVLRTIPATATLFVVYEYTKR 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 38/97 (39%)
Mito_carr 112..202 CDD:395101 28/101 (28%)
Mito_carr 210..299 CDD:395101 33/91 (36%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 102/308 (33%)
Mito_carr 170..252 CDD:278578 35/85 (41%)
Mito_carr 263..364 CDD:278578 29/109 (27%)
Mito_carr 369..455 CDD:278578 33/94 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45624
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.