DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Slc25a29

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_006240603.1 Gene:Slc25a29 / 314441 RGDID:1308104 Length:310 Species:Rattus norvegicus


Alignment Length:264 Identity:98/264 - (37%)
Similarity:139/264 - (52%) Gaps:16/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VLSGHP-LDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAM 93
            :||..| |...:||||....    |:|.||||..|....||.|.|.|||||:.:||.|:..|.|:
  Rat    19 MLSPQPSLTETEVRLQVQNT----EKPQYRGTLHCFQSIIKQESVLGLYKGLGSPLMGLTFINAL 79

  Fly    94 CFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNGM 158
            .|.  ..|..|:..|:|:.|..   |:||:.:|....:|..|.|..|..||. |..|..|.|.|.
  Rat    80 VFG--VQGNTLRALGQDSPLNQ---FLAGAAAGAIQCVICCPMELAKTRLQL-QAAGPARAYKGS 138

  Fly   159 IDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKSKSETG-QISTASTIFAGG 222
            :||..::|:..|||.:.:|..:|:||:.|:.|:|||.|:.|  ......|.| ::.....:.|||
  Rat   139 LDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVL--TRAMGCEPGDRLLVPKLLLAGG 201

  Fly   223 VAGMAYWILGMPADVLKSRLQS-APEGTYKH-GIRSVFKDLIVKDGPLALYRGVTPIMLRAFPAN 285
            .:|:..|:...|.||:|||||: ..:||.:: ||....:.....:|.....||:...:|||||.|
  Rat   202 TSGITSWLSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSYQAEGWQVFTRGLASTLLRAFPVN 266

  Fly   286 AACF 289
            ||.|
  Rat   267 AATF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 32/77 (42%)
Mito_carr 112..202 CDD:395101 33/89 (37%)
Mito_carr 210..299 CDD:395101 30/83 (36%)
Slc25a29XP_006240603.1 Mito_carr <31..83 CDD:278578 26/57 (46%)
Mito_carr 92..179 CDD:278578 34/90 (38%)
Mito_carr 189..272 CDD:278578 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.