DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Slc25a15

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001041345.1 Gene:Slc25a15 / 306574 RGDID:1311488 Length:338 Species:Rattus norvegicus


Alignment Length:343 Identity:102/343 - (29%)
Similarity:152/343 - (44%) Gaps:72/343 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KANP----VKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEG 72
            |:||    ......|..||...||:|.|.||:||::||.|       .||||..||..:|....|
  Rat     2 KSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFP-------DLYRGLTDCCLRTYSQVG 59

  Fly    73 VRGLYKGMS-APLTGVA--PIFAMCFAGYA--LGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLI 132
            .||.|||.| |.:..:|  .:..||: |:.  :.:::......|||:..|...||||:..|:.|:
  Rat    60 FRGFYKGTSPALIANIAENSVLFMCY-GFCQQVVRKVVGLDRQAKLSDLQNAAAGSFASAFAALV 123

  Fly   133 MAPGERIKVLLQTQQGQGGERKYNGMI--------DCAGKLYKEGGLRSVFKGSCATMLRDLPAN 189
            :.|.|.:|..|||..    |.:.:|.|        ....:::::.|....:.|..:|:||::|..
  Rat   124 LCPTELVKCRLQTMY----EMETSGKIAASQNTVWSVVKEIFRKDGPLGFYHGLSSTLLREVPGY 184

  Fly   190 GLYFLVYEALQDV---AKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAP----- 246
            ..:|..||..:..   .:||.|.|.|   ..:.:||..|:..|:...|.|.:|||:|...     
  Rat   185 FFFFGGYELSRSFFASGRSKDELGPI---PLMLSGGFGGICLWLAVYPVDCIKSRIQVLSMTGKQ 246

  Fly   247 -------------EGTYK------------------HGIRSV-FKDLIVKDGPLALYRGVTPIML 279
                         ||.|:                  .|:..| ...|.:::|..|||.|:.|.|:
  Rat   247 TGLIRTFLSIVKNEGGYRLSESRLYDVSFVQPKTCLSGVHYVGILKLGLREGITALYSGLKPTMI 311

  Fly   280 RAFPANAACFFGIELANK 297
            ||||||.|.|...|.:.|
  Rat   312 RAFPANGALFLAYEYSRK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 36/103 (35%)
Mito_carr 112..202 CDD:395101 27/97 (28%)
Mito_carr 210..299 CDD:395101 35/125 (28%)
Slc25a15NP_001041345.1 Mito_carr 9..94 CDD:395101 33/92 (36%)
Mito_carr <122..198 CDD:395101 19/79 (24%)
Mito_carr 205..332 CDD:395101 36/128 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.