DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Slc25a47

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001001509.1 Gene:Slc25a47 / 299316 RGDID:1303247 Length:310 Species:Rattus norvegicus


Alignment Length:306 Identity:95/306 - (31%)
Similarity:145/306 - (47%) Gaps:40/306 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAP 83
            |:.|..||:|.|..|:||||:||::||        :..|...:.|...|.:.|.:.|.|:|:|.|
  Rat     3 FVAGAIGGVCGVAVGYPLDTVKVKIQT--------EAKYTSIWHCVRDTYRQERLWGFYRGLSLP 59

  Fly    84 LTGVAPIFAMCFAGY----ALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQ 144
            :..|:.:.::.|..|    |...|.:....|.|.|...|.::|..|||....:.:|.|..||.||
  Rat    60 VCTVSLVSSVSFGTYHHCLAH
ICRFRYGSTDVKPTKADITLSGCASGLVRVFLTSPTEVAKVRLQ 124

  Fly   145 TQ-QGQGGER-------------------------KYNGMIDCAGKLYKEGGLRSVFKGSCATML 183
            || |.|..:|                         ||:|.:.|...:.:|.|||.::|||.|.:|
  Rat   125 TQAQSQTQQRRPSASWTSVAPALCPAPTACLEPRPKYSGPLHCLVTVAREEGLRGLYKGSSALLL 189

  Fly   184 RDLPANGLYFLVYEALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEG 248
            |:..:...|||.|..|.:......:: |......:.|||.||:..|.:..|.||:|||||:..:|
  Rat   190 REGHSFATYFLSYAVLSEWLT
PAGQS-QPDVLGVLVAGGCAGVLAWAVATPMDVIKSRLQADGQG 253

  Fly   249 TYKH-GIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIE 293
            ..:: |:.......:.::||..|::|:.....||||.|...|...|
  Rat   254 QQRYRGLLHCVVTSVREEGPRVLFKGLALNCCRAFPVNMVVFVAYE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 29/91 (32%)
Mito_carr 112..202 CDD:395101 37/115 (32%)
Mito_carr 210..299 CDD:395101 28/85 (33%)
Slc25a47NP_001001509.1 Solcar 1 1..80 27/84 (32%)
Mito_carr 2..74 CDD:395101 26/78 (33%)
Solcar 2 93..208 36/114 (32%)
Mito_carr 100..210 CDD:395101 34/109 (31%)
Mito_carr 215..304 CDD:395101 28/86 (33%)
Solcar 3 217..304 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.