DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and SLC25A47

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_997000.2 Gene:SLC25A47 / 283600 HGNCID:20115 Length:308 Species:Homo sapiens


Alignment Length:308 Identity:102/308 - (33%)
Similarity:146/308 - (47%) Gaps:46/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAP 83
            |:.|..||:|.|..|:||||:|||:||        :|.|.|.:.|...|...|.|.|.|:|:|.|
Human     3 FVAGAIGGVCGVAVGYPLDTVKVRIQT--------EPKYTGIWHCVRDTYHRERVWGFYRGLSLP 59

  Fly    84 LTGVAPIFAMCFAGY----ALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQ 144
            :..|:.:.::.|..|    |...||:....|||.|...|.::|..|||....:.:|.|..||.||
Human    60 VCTVSLVSSVSFGTYRHCLAHI
CRLRYGNPDAKPTKADITLSGCASGLVRVFLTSPTEVAKVRLQ 124

  Fly   145 TQ-QGQGGER-----------------------KYNGMIDCAGKLYKEGGLRSVFKGSCATMLRD 185
            || |.|..:|                       ||.|.:.|...:.:|.||..::|||.|.:|||
Human   125 TQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYKGSSALVLRD 189

  Fly   186 LPANGLYFLVY----EALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAP 246
            ..:...|||.|    |.|.....|:.:     ....:.|||.||:..|.:..|.||:|||||:..
Human   190 GHSFATYFLSYAVLCEWL
SPAGHSRPD-----VPGVLVAGGCAGVLAWAVATPMDVIKSRLQADG 249

  Fly   247 EGTYKH-GIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIE 293
            :|..:: |:.......:.::||..|::|:.....||||.|...|...|
Human   250 QGQRRYRGLLHCMVTSVREEGPRVLFKGLVLNCCRAFPVNMVVFVAYE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 34/91 (37%)
Mito_carr 112..202 CDD:395101 38/117 (32%)
Mito_carr 210..299 CDD:395101 27/85 (32%)
SLC25A47NP_997000.2 Solcar 1 1..80 31/84 (37%)
Mito_carr 2..81 CDD:278578 32/85 (38%)
Solcar 2 93..206 35/112 (31%)
Mito_carr 100..207 CDD:278578 34/106 (32%)
Solcar 3 215..302 27/88 (31%)
Mito_carr 221..302 CDD:278578 27/77 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.