DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and SLC25A45

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001339310.2 Gene:SLC25A45 / 283130 HGNCID:27442 Length:288 Species:Homo sapiens


Alignment Length:293 Identity:104/293 - (35%)
Similarity:150/293 - (51%) Gaps:27/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKG 79
            ||:.|:.|...|...::.|||.||:||||||        |..|||..||..|..::|.:.|.:||
Human     2 PVEEFVAGWISGALGLVLGHPFDTVKVRLQT--------QTTYRGIVDCMVKIYRHESLLGFFKG 58

  Fly    80 MSAPLTGVAPIFAMCFAGYA-----LGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERI 139
            ||.|:..:|.:.::.|..|:     |.....|.......:|..||:||...|......:||.:.|
Human    59 MSFPIASIAVVNSVLFGVYSNTLLV
LTATSHQERRAQPPSYMHIFLAGCTGGFLQAYCLAPFDLI 123

  Fly   140 KVLLQTQ---QGQGGE--RKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEAL 199
            ||.||.|   :.|.|.  .:|.|.:.||..:::|.|.|.:|:|:.|..|||.|..|:||:.||.|
Human   124 KVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGL 188

  Fly   200 QDVAKSKSETGQ-ISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYK---HGIRSVFKD 260
               .:..:..|| .|:|:.:.|||.||:|.|:...|.|::|||:|.  :|..:   .|:......
Human   189 ---CRQ
YTPEGQNPSSATVLVAGGFAGIASWVAATPLDMIKSRMQM--DGLRRRVYQGMLDCMVS 248

  Fly   261 LIVKDGPLALYRGVTPIMLRAFPANAACFFGIE 293
            .|.::|....:||||....||||.||..|...|
Human   249 SIRQEGLGVFFRGVTINSARAFPVNAVTFLSYE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 34/96 (35%)
Mito_carr 112..202 CDD:395101 36/94 (38%)
Mito_carr 210..299 CDD:395101 33/88 (38%)
SLC25A45NP_001339310.2 Solcar 1 1..83 33/88 (38%)
Mito_carr 2..77 CDD:395101 32/82 (39%)
Mito_carr 95..186 CDD:395101 33/90 (37%)
Solcar 2 97..191 36/96 (38%)
Mito_carr 197..288 CDD:395101 32/87 (37%)
Solcar 3 199..286 31/85 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.