DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and Slc25a29

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_851845.1 Gene:Slc25a29 / 214663 MGIID:2444911 Length:306 Species:Mus musculus


Alignment Length:274 Identity:104/274 - (37%)
Similarity:147/274 - (53%) Gaps:15/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAP 83
            ||.|..||:..|:.|||.|.:|||||....    |:|.||||..|....||.|.|.|||||:.:|
Mouse     5 FLAGCAGGVAGVIVGHPFDIVKVRLQVQST----EKPQYRGTLHCFQSIIKQESVLGLYKGLGSP 65

  Fly    84 LTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQG 148
            |.|:..|.|:.|.  ..|..|:..|:|:.|..   |:||:.:|....:|..|.|..|..||. |.
Mouse    66 LMGLTFINALVFG--VQGNTLRALGQDSPLNQ---FLAGAAAGAIQCVICCPMELAKTRLQL-QA 124

  Fly   149 QGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKSKSETG-QI 212
            .|..|.|.|.:||..::|:..|||.:.:|..:|:||:.|:.|:|||.|:.:  ......|.| ::
Mouse   125 VGPARTYKGSLDCLVQIYRHEGLRGINRGMVSTLLRETPSFGVYFLTYDVM--TRAMGCEPGDRL 187

  Fly   213 STASTIFAGGVAGMAYWILGMPADVLKSRLQS-APEGTYKH-GIRSVFKDLIVKDGPLALYRGVT 275
            .....:.|||.:|:..|:...|.||:|||||: ..:||.:: ||....:.....:|.....||:.
Mouse   188 LVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQGTPRYRGIVDCMRQSYQAEGWQVFTRGLA 252

  Fly   276 PIMLRAFPANAACF 289
            ..:|||||.|||.|
Mouse   253 STLLRAFPVNAATF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 39/87 (45%)
Mito_carr 112..202 CDD:395101 32/89 (36%)
Mito_carr 210..299 CDD:395101 30/83 (36%)
Slc25a29NP_851845.1 Mito_carr 1..79 CDD:278578 37/79 (47%)
PTZ00169 2..259 CDD:240302 97/265 (37%)
Solcar 1 2..86 39/86 (45%)
Mito_carr 88..175 CDD:278578 34/90 (38%)
Solcar 2 90..178 33/93 (35%)
Mito_carr 185..268 CDD:278578 29/82 (35%)
Solcar 3 190..275 29/77 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.