DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and SLC25A48

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_006714607.1 Gene:SLC25A48 / 153328 HGNCID:30451 Length:320 Species:Homo sapiens


Alignment Length:232 Identity:66/232 - (28%)
Similarity:108/232 - (46%) Gaps:30/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGM 80
            ::.|..|..||..:|:.||||||:|.|||.    ..|    |..|..|.....:.|.:.|.:|||
Human     6 LEDFAAGWIGGAASVIVGHPLDTVKTRLQA----GVG----YGNTLSCIRVVYRRESMFGFFKGM 62

  Fly    81 SAPLTGVAPIFAMCFAGYALGKRL--QQRGEDAKLTYPQ----IFVAGSFSGLFSTLIMAPGERI 139
            |.||..:|...::.|..::..:|.  |.|..:.:.:.|:    :.:|...:|:.|..:..|.:.|
Human    63 SFPLASIAVYNSVVFGVFSNTQRFLSQHRCGEPEASPPRTLSDLLLASMVAGVVSVGLGGPVDLI 127

  Fly   140 KVLLQTQQ---------------GQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPAN 189
            |:.||.|.               ....:..|.|.:.|...:.:..||..:::|:.|.:|||:|..
Human   128 KIRLQMQTQPFRDANLGLKSRAVAPAEQPAYQGPVHCITTIVRNEGLAGLYRGASAMLLRDVPGY 192

  Fly   190 GLYFLVYEALQDVAKSKSETGQISTASTIFAGGVAGM 226
            .|||:.|..|.:....::.||. |..:...|||:||:
Human   193 CLYFIPYVFLSEWITPEACTGP-SPCAVWLAGGMAGV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 31/92 (34%)
Mito_carr 112..202 CDD:395101 26/108 (24%)
Mito_carr 210..299 CDD:395101 7/17 (41%)
SLC25A48XP_006714607.1 Mito_carr 6..91 CDD:278578 31/92 (34%)
Mito_carr 107..207 CDD:278578 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0758
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.