DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and slc25a47

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_004917228.1 Gene:slc25a47 / 100496270 XenbaseID:XB-GENE-6041480 Length:293 Species:Xenopus tropicalis


Alignment Length:299 Identity:101/299 - (33%)
Similarity:142/299 - (47%) Gaps:44/299 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAP 83
            |:.|..||.|.|:.|:||||:|||:||        |..|.|.:.|...|.|.|.|.|.:||:|.|
 Frog     4 FIAGALGGACGVMVGYPLDTVKVRIQT--------QKNYNGIWHCVRSTYKMERVSGFFKGVSMP 60

  Fly    84 LTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYP---------QIFVAGSFSGLFSTLIMAPGERI 139
            ::.|:...::.|..|....|     ...||.|.         .||::|..:|....|:.:|.:..
 Frog    61 MSMVSVSSSIVFGVYRNVLR-----NLCK
LKYGTTAVKPSKFDIFLSGYAAGGAQILVSSPADMA 120

  Fly   140 KVLLQTQQGQGGER--------KYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVY 196
            ||.||||.......        ||:|.|:|...:.||.|...::|||.|.|.||..:...|||.|
 Frog   121 KVRLQTQMCPPNSTTCSLLTGPKYSGPINCLLTIVKEEGFLGLYKGSSALMFRDCHSFATYFLSY 185

  Fly   197 EALQD----VAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIRSV 257
            ..|::    ..:|.||     ....:||||.||:..|.:..|.||:|||||  .:|..|...|.|
 Frog   186 AILREWLL
PFEQSHSE-----LIGVLFAGGFAGVVAWGIATPMDVIKSRLQ--VDGVTKQRYRGV 243

  Fly   258 ---FKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIE 293
               ..:.:.::|...|::|::...|||||.|...|...|
 Frog   244 IHCITESVRQEGITVLFKGLSLNCLRAFPVNMVVFLTYE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 33/87 (38%)
Mito_carr 112..202 CDD:395101 35/110 (32%)
Mito_carr 210..299 CDD:395101 30/87 (34%)
slc25a47XP_004917228.1 Mito_carr 1..84 CDD:395101 33/92 (36%)
Mito_carr 100..193 CDD:395101 31/92 (34%)
Mito_carr 198..286 CDD:395101 33/92 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.