DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and LOC100495907

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_002934951.1 Gene:LOC100495907 / 100495907 -ID:- Length:309 Species:Xenopus tropicalis


Alignment Length:306 Identity:95/306 - (31%)
Similarity:146/306 - (47%) Gaps:31/306 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KANPVK------SFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKN 70
            ||.|..      :.:.|..||:..|:||.|.||.||::||.|       .:|||..|||.:|...
 Frog     5 KAPPTHLKQILINLIAGAMGGVACVVSGQPFDTAKVKMQTFP-------TMYRGFVDCAVRTYHA 62

  Fly    71 EGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQR----GEDAKLTYPQIFVAGSFSGLFSTL 131
            ||:||||.|.:..|...|...|:.||.|...:.|..|    .:.::|:......|||.:.:||:|
 Frog    63 EGLRGLYHGTTPALVANAAENAVLFACYGFCQNLVSRCLGLQDPSQLSDWHKATAGSLASVFSSL 127

  Fly   132 IMAPGERIKVLLQTQQGQGGERKYNGMIDCAGK---------LYKEGGLRSVFKGSCATMLRDLP 187
            .:.|.|.:|..:|||.    |.:.:|..|...|         :....|:..:|:|..:|.||::|
 Frog   128 ALCPTELVKCRIQTQH----EMRLSGNKDIPHKSTPWSVVRAILSSEGIPGLFRGLSSTWLREIP 188

  Fly   188 ANGLYFLVYEALQDVAKSKSETGQISTASTI-FAGGVAGMAYWILGMPADVLKSRLQSAPEGTYK 251
            ....:|..||...|:...:..:.....|..: .:|||.|..:|:...|.|.:|||:|......:.
 Frog   189 GYFFFFGGYELSIDILSQRESSKDPPGALVVTVSGGVGGACFWLAVYPVDSVKSRVQVLTLTPHS 253

  Fly   252 HGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANK 297
            .|.......::..:|.|.||.|:.|.::||||:|||.|...|:..:
 Frog   254 KGFIISLLHILRTEGFLPLYSGLMPTVVRAFPSNAALFLAYEMTKR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 38/100 (38%)
Mito_carr 112..202 CDD:395101 27/98 (28%)
Mito_carr 210..299 CDD:395101 28/89 (31%)
LOC100495907XP_002934951.1 Mito_carr 14..99 CDD:365909 35/91 (38%)
Mito_carr 109..204 CDD:365909 28/98 (29%)
Mito_carr 231..303 CDD:365909 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.