DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and slc25a29

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_002665132.2 Gene:slc25a29 / 100329459 -ID:- Length:301 Species:Danio rerio


Alignment Length:287 Identity:107/287 - (37%)
Similarity:150/287 - (52%) Gaps:27/287 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAP 83
            |..|.|||...||.|||.||:|||||..    ..::||||||..|....|:.|.:.|||||:.:|
Zfish     5 FAAGCFGGAAGVLVGHPFDTVKVRLQVQ----SVDKPLYRGTIHCFQSIIRQESMLGLYKGIGSP 65

  Fly    84 LTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQTQQG 148
            |.|:..|.|:.|.  ..|..::..|.|..|   ..|:||:.:||..::|..|.|..|..:| .||
Zfish    66 LMGLTFINAIVFG--VQGNAMRMLGSDTPL---HQFMAGAAAGLIQSVICCPMELAKTRMQ-MQG 124

  Fly   149 QG----GERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVAKSKS-- 207
            .|    ..|.|...:||..::|:..|.|.:.:|..:|::|:.|..|:|||.|:.|     ::|  
Zfish   125 TGEKSLSRRLYRNSLDCLIRIYRRQGFRGINRGMVSTVIRETPGFGIYFLTYDTL-----TRSLG 184

  Fly   208 -ETG-QISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEG---TYKHGIRSVFKDLIVKDGP 267
             |.| :......:.|||.:|:|.||...|.||:|||||:...|   .|. |:...|.....::|.
Zfish   185 CEAGDRFIVLKLLLAGGASGIASWISTYPVDVIKSRLQADGVGGDCRYS-GMLDCFAQSWQREGW 248

  Fly   268 LALYRGVTPIMLRAFPANAACFFGIEL 294
            .|..||:|..:|||||.||..|..:.|
Zfish   249 RAFTRGLTSTLLRAFPVNATTFATVTL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 38/87 (44%)
Mito_carr 112..202 CDD:395101 31/93 (33%)
Mito_carr 210..299 CDD:395101 34/89 (38%)
slc25a29XP_002665132.2 Mito_carr 16..90 CDD:278578 34/79 (43%)
Mito_carr 88..184 CDD:278578 34/104 (33%)
Mito_carr 193..272 CDD:278578 32/79 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.