DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and slc25a45

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_002662242.1 Gene:slc25a45 / 100329446 -ID:- Length:284 Species:Danio rerio


Alignment Length:289 Identity:106/289 - (36%)
Similarity:150/289 - (51%) Gaps:22/289 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKG 79
            |...|:.|...|...::.||||||:||||||        |.:|.|..||..||...||:.|.:||
Zfish     2 PFVEFIAGWISGAVGLVVGHPLDTVKVRLQT--------QSVYGGILDCVIKTYTREGLHGFFKG 58

  Fly    80 MSAPLTGVAPIFAMCFAGY--ALGKRLQQRGED----AKLTYPQIFVAGSFSGLFSTLIMAPGER 138
            ||.|:..||...|:.|..|  ||....|....|    :.|:|  :|:||.||||....:.||.:.
Zfish    59 MSFPVLSVAVSNAVAFGSYSNALDYLTQSHHNDHSQRSPLSY--VFMAGCFSGLAQLFVTAPIDL 121

  Fly   139 IKVLLQTQ-QGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYE-ALQD 201
            :||.||.| :.:....||.|.:.|...:.:|.||:.:|:|..|..|||:|..|||||.|| .|:.
Zfish   122 VKVRLQNQTRSRSAGNKYRGPLHCVAVIVREDGLKGLFRGFWALALRDVPCYGLYFLPYEFTLRM 186

  Fly   202 VAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQ-SAPEGTYKHGIRSVFKDLIVKD 265
            :.:...:.|.   .:.:.||||||:..|....|.||:|:||| |...|....|:.:.....:.::
Zfish   187 MTEKGKQPGH---CAVLAAGGVAGVITWACATPMDVVKARLQMSGGGGRVYSGVLNCITVSVREE 248

  Fly   266 GPLALYRGVTPIMLRAFPANAACFFGIEL 294
            |....::|:....:||||.||..|...|:
Zfish   249 GIRVFFKGLLLNSVRAFPVNAVTFLSYEM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 39/93 (42%)
Mito_carr 112..202 CDD:395101 38/91 (42%)
Mito_carr 210..299 CDD:395101 28/86 (33%)
slc25a45XP_002662242.1 Mito_carr 2..85 CDD:278578 38/90 (42%)
Mito_carr 94..191 CDD:278578 38/98 (39%)
Mito_carr 200..280 CDD:278578 27/78 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.