DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and slc25a45

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:XP_012816001.1 Gene:slc25a45 / 100127755 XenbaseID:XB-GENE-1006763 Length:332 Species:Xenopus tropicalis


Alignment Length:273 Identity:96/273 - (35%)
Similarity:135/273 - (49%) Gaps:25/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQ 105
            |||||..|        |||..||..:|.:||.:.|.:||||.|:..||...::.|..|:......
 Frog    70 VRLQTQSR--------YRGILDCVIQTYRNETIFGFFKGMSFPVGSVAISNSLAFGSYSNALLYL 126

  Fly   106 QRGEDAKLTYP----QIFVAGSFSGLFSTLIMAPGERIKVLLQTQ------QGQGG--ERKYNGM 158
            ...|......|    .:|:||.|||:......||.:.:||.||.|      |.:.|  :.:|.|.
 Frog   127 SDQEIKNWKNPPHNCHVFMAGCFSGIVQLSFSAPVDLVKVRLQNQTESFGNQARPGHLQARYQGP 191

  Fly   159 IDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEAL-QDVAKSKSETGQISTASTIFAGG 222
            :.||..:::|.|:..:::|..|..|||:|:.|||||.||.| :.:.||..|.   |..:.:||||
 Frog   192 VHCAVCIFREEGIFGLYRGCLALALRDIPSMGLYFLTYEVLCKWMTKSLDEP---SAWTMLFAGG 253

  Fly   223 VAGMAYWILGMPADVLKSRLQ-SAPEGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANA 286
            .||...|....|.||:|:||| ....|....|:....:..|.::|.....:|:|...|||||.||
 Frog   254 CAGTVGWAFANPMDVIKARLQMDGMHGVQYLGMLDCIRKSIRQEGVKVFLKGLTINSLRAFPVNA 318

  Fly   287 ACFFGIELANKFF 299
            ..|...|:..|.|
 Frog   319 VTFLSYEMLLKAF 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 24/65 (37%)
Mito_carr 112..202 CDD:395101 36/102 (35%)
Mito_carr 210..299 CDD:395101 31/89 (35%)
slc25a45XP_012816001.1 Mito_carr <70..128 CDD:278578 24/65 (37%)
Mito_carr 144..240 CDD:278578 36/95 (38%)
Mito_carr 241..332 CDD:278578 33/94 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.